PDB entry 1kwt

View 1kwt on RCSB PDB site
Description: Rat mannose binding protein A (native, MPD)
Class: immune system, sugar binding protein
Keywords: lectin, c-type lectin, calcium-binding protein, immune system, sugar binding protein
Deposited on 2002-01-30, released 2002-07-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.198
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mannose-binding protein a
    Species: Rattus norvegicus [TaxId:10116]
    Gene: MBL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kwta1, d1kwta2
  • Chain 'B':
    Compound: mannose-binding protein a
    Species: Rattus norvegicus [TaxId:10116]
    Gene: MBL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kwtb1, d1kwtb2
  • Chain 'C':
    Compound: mannose-binding protein a
    Species: Rattus norvegicus [TaxId:10116]
    Gene: MBL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kwtc1, d1kwtc2
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kwtA (A:)
aievklanmeaeintlkskleltnklhafsmgkksgkkffvtnhermpfskvkalcselr
gtvaiprnaeenkaiqevaktsaflgitdevtegqfmyvtggrltysnwkkdepndhgsg
edcvtivdnglwndiscqashtavcefpa

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kwtB (B:)
aievklanmeaeintlkskleltnklhafsmgkksgkkffvtnhermpfskvkalcselr
gtvaiprnaeenkaiqevaktsaflgitdevtegqfmyvtggrltysnwkkdepndhgsg
edcvtivdnglwndiscqashtavcefpa

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kwtC (C:)
aievklanmeaeintlkskleltnklhafsmgkksgkkffvtnhermpfskvkalcselr
gtvaiprnaeenkaiqevaktsaflgitdevtegqfmyvtggrltysnwkkdepndhgsg
edcvtivdnglwndiscqashtavcefpa