PDB entry 1kef

View 1kef on RCSB PDB site
Description: PDZ1 of SAP90
Class: protein binding
Keywords: beta-sheet, anti-parallel beta-sandwich, GLGF loop, PROTEIN BINDING
Deposited on 2001-11-15, released 2002-03-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: synapse associated protein-90
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P78352 (0-92)
  Domains in SCOPe 2.05: d1kefa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kefA (A:)
  eyeeitlergnsglgfsiaggtdnphigddpsifitkiipggaaaqdgrlrvndsilfvn
  evdvrevthsaavealkeagsivrlyvmrrkpp