PDB entry 1keb

View 1keb on RCSB PDB site
Description: Crystal Structure of Double Mutant M37L,P40S E.coli Thioredoxin
Class: electron transport
Keywords: Thioredoxin fold, Proline, alpha-helix, ELECTRON TRANSPORT
Deposited on 2001-11-15, released 2002-11-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Thioredoxin 1
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AA25 (0-107)
    • engineered (36)
    • engineered (39)
  Domains in SCOPe 2.05: d1keba_
• Chain 'B':
  Compound: Thioredoxin 1
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AA25 (0-107)
    • engineered (36)
    • engineered (39)
  Domains in SCOPe 2.05: d1kebb_
• Heterogens: CU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kebA (A:)
  sdkiihltddsfdtdvlkadgailvdfwaewcgpckliasildeiadeyqgkltvaklni
  dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kebB (B:)
  sdkiihltddsfdtdvlkadgailvdfwaewcgpckliasildeiadeyqgkltvaklni
  dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla