PDB entry 1kc2

View 1kc2 on RCSB PDB site
Description: structure of the triple (Lys(beta)D3Ala, Asp(beta)C8Ala, AspCD2Ala) mutant of the Src SH2 domain bound to the PQpYEEIPI peptide
Class: transferase
Keywords: SH2 domain, phosphotyrosine, TRANSFERASE
Deposited on 2001-11-07, released 2002-04-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.229
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Src Tyrosine kinase
    Species: Rous sarcoma virus [TaxId:11886]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00524 (0-102)
      • engineered (55)
    Domains in SCOPe 2.06: d1kc2a_
  • Chain 'B':
    Compound: PQpYEEIPI peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1KC2 (0-7)
  • Heterogens: CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1kc2A (A:)
aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsafanakglnvahyki
rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt

    Sequence, based on observed residues (ATOM records): (download) 
    >1kc2A (A:)
aeewyfgkitrreserlllnpenprgtflvresettkgayclsvslnvahykirkldsgg
fyitsrtqfsslqqlvayyskhadglchrltnvcpt

  • Chain 'B':
    No sequence available.