PDB entry 1kaa

View 1kaa on RCSB PDB site
Description: stress and strain in staphylococcal nuclease
Class: hydrolase(phosphoric diester)
Keywords: hydrolase(phosphoric diester)
Deposited on 1992-12-18, released 1994-01-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: staphylococcal nuclease
  Species: Staphylococcus aureus [TaxId:1280]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00644 (0-135)
    • conflict (110)
  Domains in SCOPe 2.06: d1kaaa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kaaA (A:)
  klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
  venakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvyapnntheqhl
  rkseaqakkeklniws