PDB entry 1k6c
View 1k6c on RCSB PDB site
Description: lack of synergy for inhibitors targeting a multi-drug resistant hiv-1 protease
Class: hydrolase
Keywords: indinavir, inhibitor recognition, drug resistance, hiv-1 protease, hydrolase
Deposited on
2001-10-15, released
2002-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.194
AEROSPACI score: 0.41
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Pol polyprotein
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
- Uniprot P35963 (0-98)
- engineered (6)
- engineered (13)
- engineered (81)
- engineered (83)
Domains in SCOPe 2.08: d1k6ca_ - Chain 'B':
Compound: Pol polyprotein
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
- Uniprot P35963 (0-98)
- engineered (6)
- engineered (13)
- engineered (81)
- engineered (83)
Domains in SCOPe 2.08: d1k6cb_ - Heterogens: ACT, MK1, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1k6cA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1k6cB (B:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf