SCOPe 2.08: Structural Classification of Proteins

PDB entry 1k0u

View 1k0u on RCSB PDB site
Description: Inhibition of S-adenosylhomocysteine Hydrolase by "acyclic sugar" Adenosine Analogue D-eritadenine
Class: hydrolase
Keywords: S-adenosylhomocysteine, hydrolase, D-eritadenine, inhibitor
Deposited on 2001-09-20, released 2001-10-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.183
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: s-adenosyl-l-homocysteine hydrolase
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
- Uniprot P10760 (Start-430)
Domains in SCOPe 2.08: d1k0ua1, d1k0ua2
Chain 'B':
Compound: s-adenosyl-l-homocysteine hydrolase
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
- Uniprot P10760 (Start-430)
Domains in SCOPe 2.08: d1k0ub1, d1k0ub2
Chain 'C':
Compound: s-adenosyl-l-homocysteine hydrolase
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
- Uniprot P10760 (Start-430)
Domains in SCOPe 2.08: d1k0uc1, d1k0uc2
Chain 'D':
Compound: s-adenosyl-l-homocysteine hydrolase
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
- Uniprot P10760 (Start-430)
Domains in SCOPe 2.08: d1k0ud1, d1k0ud2
Chain 'E':
Compound: s-adenosyl-l-homocysteine hydrolase
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
- Uniprot P10760 (Start-430)
Domains in SCOPe 2.08: d1k0ue1, d1k0ue2
Chain 'F':
Compound: s-adenosyl-l-homocysteine hydrolase
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
- Uniprot P10760 (Start-430)
Domains in SCOPe 2.08: d1k0uf1, d1k0uf2
Chain 'G':
Compound: s-adenosyl-l-homocysteine hydrolase
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
- Uniprot P10760 (Start-430)
Domains in SCOPe 2.08: d1k0ug1, d1k0ug2
Chain 'H':
Compound: s-adenosyl-l-homocysteine hydrolase
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
- Uniprot P10760 (Start-430)
Domains in SCOPe 2.08: d1k0uh1, d1k0uh2
Heterogens: NAD, DEA, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1k0uA (A:)
adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
teidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
ngpfkpdhyry