PDB entry 1jvb

View 1jvb on RCSB PDB site
Description: alcohol dehydrogenase from the archaeon sulfolobus solfataricus
Class: oxidoreductase
Keywords: archaeon, zinc, nad, oxidoreductase
Deposited on 2001-08-29, released 2002-08-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.191
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nad(h)-dependent alcohol dehydrogenase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: ADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39462 (0-346)
      • modified residue (0)
      • modified residue (43)
      • modified residue (137)
      • modified residue (185)
      • modified residue (268)
      • modified residue (305)
      • modified residue (316)
      • modified residue (321)
    Domains in SCOPe 2.05: d1jvba1, d1jvba2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jvbA (A:)
    mravrlveigkplslqeigvpkpkgpqvlikveaagvchsdvhmrqgrfgnlrivedlgv
    klpvtlgheiagkieevgdevvgyskgdlvavnpwqgegncyycrigeehlcdsprwlgi
    nfdgayaeyvivphykymyklrrlnaveaapltcsgittyravrkasldptktllvvgag
    gglgtmavqiakavsgatiigvdvreeaveaakragadyvinasmqdplaeirriteskg
    vdavidlnnsektlsvypkalakqgkyvmvglfgadlhyhaplitlseiqfvgslvgnqs
    dflgimrlaeagkvkpmitktmkleeaneaidnlenfkaigrqvlip