PDB entry 1jq8

View 1jq8 on RCSB PDB site
Description: Design of specific inhibitors of phospholipase A2: Crystal structure of a complex formed between phospholipase A2 from Daboia russelli pulchella and a designed pentapeptide Leu-Ala-Ile-Tyr-Ser at 2.0 resolution
Class: hydrolase/hydrolase inhibitor
Keywords: neurotoxic, designed peptide, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2001-08-04, released 2002-11-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Daboia russellii pulchella [TaxId:97228]
    Database cross-references and differences (RAF-indexed):
    • PDB 1JQ8 (0-120)
    Domains in SCOPe 2.05: d1jq8a_
  • Chain 'B':
    Compound: phospholipase a2
    Species: Daboia russellii pulchella [TaxId:97228]
    Database cross-references and differences (RAF-indexed):
    • PDB 1JQ8 (0-120)
    Domains in SCOPe 2.05: d1jq8b_
  • Chain 'P':
    Compound: peptide inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1JQ8 (0-4)
  • Heterogens: SO4, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jq8A (A:)
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jq8B (B:)
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

  • Chain 'P':
    No sequence available.