PDB entry 1jq8
View 1jq8 on RCSB PDB site
Description: Design of specific inhibitors of phospholipase A2: Crystal structure of a complex formed between phospholipase A2 from Daboia russelli pulchella and a designed pentapeptide Leu-Ala-Ile-Tyr-Ser at 2.0 resolution
Class: hydrolase/hydrolase inhibitor
Keywords: neurotoxic, designed peptide, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on
2001-08-04, released
2002-11-06
The last revision prior to the SCOPe 2.05 freeze date was dated
2011-11-16, with a file datestamp of
2011-11-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.46
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: phospholipase a2
Species: Daboia russellii pulchella [TaxId:97228]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1jq8a_ - Chain 'B':
Compound: phospholipase a2
Species: Daboia russellii pulchella [TaxId:97228]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1jq8b_ - Chain 'P':
Compound: peptide inhibitor
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: SO4, ACY, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1jq8A (A:)
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1jq8B (B:)
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c
- Chain 'P':
No sequence available.