PDB entry 1jni

View 1jni on RCSB PDB site
Description: Structure of the NapB subunit of the periplasmic nitrate reductase from Haemophilus influenzae.
Class: oxidoreductase
Keywords: dihaem cytochrome c, proteolytic fragment, nitrate reductase subunit, OXIDOREDUCTASE
Deposited on 2001-07-24, released 2002-05-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.16
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diheme cytochrome c napb
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jnia_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jniA (A:)
    dapavgkdltqaaenippafhnaprqgelpalnyvnqppmvphsvanyqvtknvnqclnc
    hspensrlsgatrispthfmdrdgkvgssssprryfclqchvsqanvdpivpndfkpmkg
    ygn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jniA (A:)
    nqppmvphsvanyqvtknvnqclnchspensrlsgatrispthfmdrdgkvsprryfclq
    chvs