PDB entry 1jh3

View 1jh3 on RCSB PDB site
Description: Solution structure of tyrosyl-tRNA synthetase C-terminal domain.
Class: ligase
Keywords: aminoacyl-tRNA synthetase, anticodon-arm binding domain, LIGASE
Deposited on 2001-06-27, released 2002-03-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosyl-tRNA synthetase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: tyrS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jh3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1jh3A (A:)
alfsgdianltaaeieqgfkdvpsfvheggdvplvellvsagispskrqarediqngaiy
vngerlqdvgailtaehrlegrftvirrgkkkyyliryalehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >1jh3A (A:)
alfsgdianltaaeieqgfkdvpsfvheggdvplvellvsagispskrqarediqngaiy
vngerlqdvgailtaehrlegrftvirrgkkkyylirya