PDB entry 1j0t

View 1j0t on RCSB PDB site
Description: The solution structure of molt-inhibiting hormone from the kuruma prawn
Class: Hormone/growth factor
Keywords: ALPHA-HELICAL PROTEIN, Hormone/growth factor COMPLEX
Deposited on 2002-11-22, released 2002-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: molt-inhibiting hormone
  Species: Marsupenaeus japonicus [TaxId:27405]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P55847 (0-77)
  Domains in SCOPe 2.08: d1j0ta_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1j0tA (A:)
  asfidntcrgvmgnrdiykkvvrvcedctnifrlpgldgmcrnrcfynewfliclkaanr
  edeiekfrvwisilnagq