PDB entry 1irg

View 1irg on RCSB PDB site
Description: interferon regulatory factor-2 DNA binding domain, nmr, 20 structures
Class: transcription regulation
Keywords: transcription regulation, winged helix-turn-helix
Deposited on 1997-11-25, released 1998-03-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interferon regulatory factor-2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1irga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1irgA (A:)
    pvermrmrpwleeqinsntipglkwlnkekkifqipwmhaarhgwdvekdaplfrnwaih
    tgkhqpgidkpdpktwkanfrcamnslpdieevkdrsikkgnnafrvyrmlp