PDB entry 1iq3

View 1iq3 on RCSB PDB site
Description: solution structure of the eps15 homology domain of a human pob1
Class: endocytosis/exocytosis
Keywords: EF-hand domain, POB1 EH DOMAIN, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2001-06-06, released 2001-06-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ralbp1-interacting protein (partner of ralbp1)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NFH8 (2-104)
      • see remark 999 (0-1)
      • see remark 999 (105-109)
    Domains in SCOPe 2.08: d1iq3a1, d1iq3a2
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1iq3A (A:)
gslqdnssypdepwriteeqreyyvnqfrslqpdpssfisgsvaknfftksklsipelsy
iwelsdadcdgaltlpefcaafhlivarkngyplpeglpptlqpefivtd