PDB entry 1ip9

View 1ip9 on RCSB PDB site
Description: solution structure of the pb1 domain of bem1p
Class: signaling protein
Keywords: ubiquitin alpha/beta roll, SIGNALING PROTEIN
Deposited on 2001-04-26, released 2001-08-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bem1 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29366 (5-84)
      • cloning artifact (0-4)
    Domains in SCOPe 2.05: d1ip9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ip9A (A:)
    gamgsstsglkttkikfyykddifalmlkgdttykelrskiapridtdnfklqtklfdgs
    geeiktdsqvsniiqaklkisvhdi