PDB entry 1igv

View 1igv on RCSB PDB site
Description: bovine calbindin d9k binding mn2+
Class: metal binding protein
Keywords: calcium-binding protein, ef-hand, manganese binding, metal binding protein
Deposited on 2001-04-18, released 2001-04-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.186
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: vitamin d-dependent calcium-binding protein, intestinal
  Species: Bos taurus [TaxId:9913]
  Gene: synthetic gene
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02633 (0-74)
  Domains in SCOPe 2.06: d1igva_
• Heterogens: MN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1igvA (A:)
  kspeelkgifekyaakegdpnqlskeelklllqtefpsllkgpstldelfeeldkngdge
  vsfeefqvlvkkisq