PDB entry 1ie5

View 1ie5 on RCSB PDB site
Description: nmr structure of the third immunoglobulin domain from the neural cell adhesion molecule.
Class: cell adhesion
Keywords: Intermediate Immunoglobulin fold, CELL ADHESION
Deposited on 2001-04-06, released 2001-08-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: neural cell adhesion molecule
  Species: Gallus gallus [TaxId:9031]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13590 (1-106)
    • cloning artifact (0)
  Domains in SCOPe 2.08: d1ie5a1, d1ie5a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ie5A (A:)
  gkdiqvivnvppsvrarqstmnatanlsqsvtlacdadgfpeptmtwtkdgepieqedne
  ekysfnydgseliikkvdksdeaeyiciaenkageqdatihlkvfak