PDB entry 1hrq

View 1hrq on RCSB PDB site
Description: the three-dimensional solution structure of the reduced high-potential iron-sulfur protein from chromatium vinosum through nmr
Class: electron transfer (iron-sulfur protein)
Keywords: electron transfer (iron-sulfur protein)
Deposited on 1995-01-17, released 1995-06-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: high potential iron sulfur protein
  Species: Allochromatium vinosum [TaxId:1049]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00260 (0-84)
  Domains in SCOPe 2.08: d1hrqa_
• Heterogens: SF4

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hrqA (A:)
  sapanavaaddataialkynqdatkservaaarpglppeeqhcancqfmqadaagatdew
  kgcqlfpgklinvngwcaswtlkag