PDB entry 1hkf

View 1hkf on RCSB PDB site
Description: the three dimensional structure of nk cell receptor nkp44, a triggering partner in natural cytotoxicity
Class: receptor
Keywords: natural cytotoxicity receptor, nkp44, receptor, immunoglobulin domain
Deposited on 2003-03-10, released 2003-06-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2399
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nk cell activating receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1HKF
    • Uniprot O95944 (Start-121)
    Domains in SCOPe 2.01: d1hkfa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1hkfA (A:)
megshhhhhhsqaqskaqvlqsvagqtltvrcqypptgslyekkgwckeasalvcirlvt
sskprtmawtsrftiwddpdagfftvtmtdlreedsghywcriyrpsdnsvsksvrfylv
vs

    Sequence, based on observed residues (ATOM records): (download) 
    >1hkfA (A:)
skaqvlqsvagqtltvrcqypptgslyekkgwckeasalvcirlvtsskprtmawtsrft
iwddpdagfftvtmtdlreedsghywcriyrpsdnsvsksvrfylvvs