PDB entry 1hii

View 1hii on RCSB PDB site
Description: comparative analysis of the x-ray structures of hiv-1 and hiv-2 proteases in complex with cgp 53820, a novel pseudosymmetric inhibitor
Class: hydrolase (aspartic proteinase)
Keywords: aspartate protease, inhibited, hiv, hydrolase (aspartic proteinase)
Deposited on 1995-03-31, released 1995-07-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.138
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-2 protease
  Species: Human immunodeficiency virus 2 [TaxId:11709]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04584 (0-98)
  Domains in SCOPe 2.05: d1hiia_
• Chain 'B':
  Compound: hiv-2 protease
  Species: Human immunodeficiency virus 2 [TaxId:11709]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04584 (0-98)
  Domains in SCOPe 2.05: d1hiib_
• Heterogens: SO4, C20, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hiiA (A:)
  pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk
  nveievlnkkvratimtgdtpinifgrniltalgmslnl
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hiiB (B:)
  pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk
  nveievlnkkvratimtgdtpinifgrniltalgmslnl