PDB entry 1h98

View 1h98 on RCSB PDB site
Description: new insights into thermostability of bacterial ferredoxins: high resolution crystal structure of the seven-iron ferredoxin from thermus thermophilus
Class: electron transport
Keywords: electron transport, thermophilic, iron-sulfur, azotobacter, hydrogen bonds, stability, high resolution
Deposited on 2001-03-05, released 2001-11-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.159
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03942 (69-End)
      • conflict (5)
    Domains in SCOPe 2.08: d1h98a_
  • Heterogens: SF4, F3S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h98A (A:)
    phvicepcigvkdqscvevcpveciydggdqfyihpeecidcgacvpacpvnaiypeedv
    peqwksyieknrklagle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h98A (A:)
    phvicepcigvkdqscvevcpveciydggdqfyihpeecidcgacvpacpvnaiypeedv
    peqwksyieknrklagl