PDB entry 1h95

View 1h95 on RCSB PDB site
Description: solution structure of the single-stranded DNA-binding cold shock domain (csd) of human y-box protein 1 (yb1) determined by nmr (10 lowest energy structures)
Class: translation factor
Keywords: translation factor, transcription factor, ob-fold, 5-stranded anti-parallel beta-barrel, single stranded DNA binding, cold shock, y-box
Deposited on 2001-02-23, released 2002-02-21
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: y-box binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H95 (0-78)
    Domains in SCOPe 2.01: d1h95a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1h95A (A:)
mkkviatkvlgtvkwfnvrngygfinrndtkedvfvhqtaikknnprkylrsvgdgetve
fdvvegekgaeaanvtgpg