PDB entry 1h91

View 1h91 on RCSB PDB site
Description: the crystal structure of lobster apocrustacyanin a1 using softer x-rays.
Class: apocrustacyanin
Keywords: apocrustacyanin, softer x-rays, xenon, sulphurs
Deposited on 2001-02-21, released 2001-09-06
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.1766
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: crustacyanin a1 subunit
    Species: HOMARUS GAMMARUS [TaxId:6707]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H91 (0-179)
    Domains in SCOPe 2.02: d1h91a_
  • Chain 'B':
    Compound: crustacyanin a1 subunit
    Species: HOMARUS GAMMARUS [TaxId:6707]
    Database cross-references and differences (RAF-indexed):
    • PDB 1H91 (0-179)
    Domains in SCOPe 2.02: d1h91b_
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1h91A (A:)
kipnfvvpgkcasvdrnklwaeqtpnrnsyagvwyqfaltnnpyqliekcvrneysfdgk
qfvikstgiaydgnllkrngklypnpfgephlsidyensfaaplviletdysnyaclysc
idynfgyhsdfsfifsrsanladqyvkkceaafkninvdttrfvktvqgsscpydtqktv

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1h91B (B:)
kipnfvvpgkcasvdrnklwaeqtpnrnsyagvwyqfaltnnpyqliekcvrneysfdgk
qfvikstgiaydgnllkrngklypnpfgephlsidyensfaaplviletdysnyaclysc
idynfgyhsdfsfifsrsanladqyvkkceaafkninvdttrfvktvqgsscpydtqktv