PDB entry 1gn8

View 1gn8 on RCSB PDB site
Description: phosphopantetheine adenylyltransferase in complex with mn2+ ATP from escherichia coli
Class: transferase
Keywords: transferase, coenzyme a biosynthesis, nucleotidyltransferase
Deposited on 2001-10-03, released 2002-01-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.229
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gn8a_
  • Chain 'B':
    Compound: phosphopantetheine adenylyltransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gn8b_
  • Heterogens: SO4, ATP, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gn8A (A:)
mqkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqata
hlgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmp
skewsfissslvkevarhqgdvthflpenvhqalmakla

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gn8B (B:)
mqkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqata
hlgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmp
skewsfissslvkevarhqgdvthflpenvhqalmakla