PDB entry 1ggs

View 1ggs on RCSB PDB site
Description: nmr structure of the c terminal domain of cardiac troponin c bound to the n terminal domain of cardiac troponin I.
Class: contractile protein
Keywords: troponin c-troponin I interaction, cardiac, muscle protein, calcium binding protein
Deposited on 1999-04-28, released 2000-04-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2000-08-23, with a file datestamp of 2007-04-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (troponin c)
  Species: GALLUS GALLUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09860 (0-80)
  Domains in SCOPe 2.06: d1ggsa_
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ggsA (A:)
  mvrcmkddskgkteeelsdlfrmfdknadgyidleelkimlqatgetiteddieelmkdg
  dknndgridydeflefmkgve