PDB entry 1gcs

View 1gcs on RCSB PDB site
Description: structure of the bovine gamma-b crystallin at 150k
Class: eye lens protein
Keywords: eye lens protein
Deposited on 1994-01-27, released 1994-04-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.17
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gamma-b crystallin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gcsa1, d1gcsa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gcsA (A:)
gkitfyedrgfqghcyecssdcpnlqpyfsrcnsirvdsgcwmlyerpnyqghqyflrrg
dypdyqqwmgfndsirscrlipqhtgtfrmriyerddfrgqmseitddcpslqdrfhlte
vhslnvlegswvlyempsyrgrqyllrpgeyrryldwgamnakvgslrrvmdfy