PDB entry 1fyv

View 1fyv on RCSB PDB site
Description: crystal structure of the tir domain of human tlr1
Class: signaling protein
Keywords: beta-alpha-beta fold parallel beta sheet, SIGNALING PROTEIN
Deposited on 2000-10-03, released 2000-11-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.254
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: toll-like receptor 1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15399 (0-160)
    • modified residue (39)
    • modified residue (125)
  Domains in SCOPe 2.05: d1fyva_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fyvA (A:)
  nipleelqrnlqfhafisysghdsfwvknellpnlekegmqiclhernfvpgksivenii
  tcieksyksifvlspnfvqsewchyelyfahhnlfhegsnslilillepipqysipssyh
  klkslmarrtylewpkekskrglfwanlraainiklteqak