PDB entry 1fff
View 1fff on RCSB PDB site
Description: structural implications of drug resistant mutants of hiv-1 protease : high resolution crystal structures of the mutant protease/substrate analog complexes.
Class: hydrolase/hydrolase inhibitor
Keywords: hiv-1 protease, hydrolase-hydrolase inhibitor complex
Deposited on
2000-07-25, released
2001-06-01
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.212
AEROSPACI score: 0.46
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'C':
Compound: protease retropepsin
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot P04587
- engineered (6)
- engineered (29)
- engineered (32)
- engineered (62)
- engineered (66)
- engineered (94)
Domains in SCOPe 2.06: d1fffc_ - Chain 'D':
Compound: protease retropepsin
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot P04587 (0-98)
- engineered (6)
- engineered (29)
- engineered (32)
- engineered (62)
- engineered (66)
- engineered (94)
Domains in SCOPe 2.06: d1fffd_ - Heterogens: 0Q4, HOH
PDB Chain Sequences:
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1fffC (C:)
pqitlwkrplvtikiggqlkealldtgadntvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1fffD (D:)
pqitlwkrplvtikiggqlkealldtgadntvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf