PDB entry 1ff4

View 1ff4 on RCSB PDB site
Description: x-ray structure of muscarinic toxin 2 at 1.5 angstrom resolution
Class: toxin
Keywords: three fingers motif, TOXIN
Deposited on 2000-07-25, released 2003-07-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.205
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: muscarinic toxin/acetylcholine receptor binding protein
    Species: Dendroaspis angusticeps [TaxId:8618]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ff4a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ff4A (A:)
    ltcvttksiggvttedcpagqnvcfkrwhyvtpknydiikgcaatcpkvdnndpirccgt
    dkcnd