PDB entry 1fd3

View 1fd3 on RCSB PDB site
Description: human beta-defensin 2
Class: antimicrobial protein
Keywords: defensin, human beta-defensin 2, beta-defensin, antimicrobial protein
Deposited on 2000-07-19, released 2000-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.16
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-defensin 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fd3a_
  • Chain 'B':
    Compound: beta-defensin 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fd3b_
  • Chain 'C':
    Compound: beta-defensin 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fd3c_
  • Chain 'D':
    Compound: beta-defensin 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fd3d_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fd3A (A:)
gigdpvtclksgaichpvfcprrykqigtcglpgtkcckkp

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1fd3B (B:)
gigdpvtclksgaichpvfcprrykqigtcglpgtkcckkp

    Sequence, based on observed residues (ATOM records): (download) 
    >1fd3B (B:)
gigdpvtclksgaichpvfcprrykqigtcglpgtkcckk

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >1fd3C (C:)
gigdpvtclksgaichpvfcprrykqigtcglpgtkcckkp

    Sequence, based on observed residues (ATOM records): (download) 
    >1fd3C (C:)
gigdpvtclksgaichpvfcprrykqigtcglpgtkcckk

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fd3D (D:)
gigdpvtclksgaichpvfcprrykqigtcglpgtkcckkp