PDB entry 1f9p

View 1f9p on RCSB PDB site
Description: crystal structure of connective tissue activating peptide-III(ctap-III) complexed with polyvinylsulfonic acid
Class: blood clotting
Keywords: chemokine-heparin analog complex, BLOOD CLOTTING
Deposited on 2000-07-11, released 2003-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: connective tissue activating peptide-III
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02775 (0-End)
  Domains in SCOPe 2.08: d1f9pa_
• Heterogens: ESA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1f9pA (A:)
  nlakgkeesldsdlyaelrcmcikttsgihpkniqslevigkgthcnqveviatlkdgrk
  icldpdaprikkivqkklagdesad
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1f9pA (A:)
  nlakgkeesldsdlyaelrcmcikttsgihpkniqslevigkgthcnqveviatlkdgrk
  icldpdaprikkivqkklagd