PDB entry 1f6v

View 1f6v on RCSB PDB site
Description: solution structure of the c terminal of mu b transposition protein
Class: DNA binding protein
Keywords: Mu phage, recombination, transposition, ATPase, DNA binding, NMR, high salt, solution structure, DNA BINDING PROTEIN
Deposited on 2000-06-23, released 2000-11-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA transposition protein
    Species: Enterobacteria phage Mu [TaxId:10677]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03763 (1-90)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d1f6va1, d1f6va2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6vA (A:)
    gsriakrtainktkkadvkaiadawqingekelellqqiaqkpgalrilnhslrlaamta
    hgkgervnedylrqafreldldvdistllrn