PDB entry 1eq7

View 1eq7 on RCSB PDB site
Description: core structure of the outer membrane lipoprotein from escherichia coli at 1.9 angstrom resolution
Class: membrane protein
Keywords: lipoprotein, outer membrane, protein folding, helix capping, MEMBRANE PROTEIN
Deposited on 2000-04-03, released 2000-06-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.214
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: outer membrane lipoprotein
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P69776 (0-55)
  Domains in SCOPe 2.08: d1eq7a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eq7A (A:)
  ssnakidqlssdvqtlnakvdqlsndvnamrsdvqaakddaaranqrldnmatkyr