PDB entry 1ego

View 1ego on RCSB PDB site
Description: nmr structure of oxidized escherichia coli glutaredoxin: comparison with reduced e. coli glutaredoxin and functionally related proteins
Class: electron transport
Keywords: electron transport
Deposited on 1991-10-08, released 1993-10-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutaredoxin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1egoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egoA (A:)
    mqtvifgrsgcpycvrakdlaeklsnerddfqyqyvdiraegitkedlqqkagkpvetvp
    qifvdqqhiggytdfaawvkenlda