PDB entry 1dyh

View 1dyh on RCSB PDB site
Description: isomorphous crystal structures of escherichia coli dihydrofolate reductase complexed with folate, 5-deazafolate and 5,10-dideazatetrahydrofolate: mechanistic implications
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1994-10-26, released 1995-06-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.149
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABQ4 (0-158)
      • conflict (36)
    Domains in SCOPe 2.05: d1dyha_
  • Chain 'B':
    Compound: dihydrofolate reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABQ4 (0-158)
      • conflict (36)
    Domains in SCOPe 2.05: d1dyhb_
  • Heterogens: CL, CA, DZF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dyhA (A:)
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dyhB (B:)
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr