PDB entry 1drb

View 1drb on RCSB PDB site
Description: crystal structure of unliganded escherichia coli dihydrofolate reductase. ligand-induced conformational changes and cooperativity in binding
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1991-11-06, released 1994-01-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.149
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABQ4 (0-158)
      • conflict (26)
      • conflict (36)
    Domains in SCOPe 2.05: d1drba_
  • Chain 'B':
    Compound: dihydrofolate reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABQ4 (0-158)
      • conflict (26)
      • conflict (36)
    Domains in SCOPe 2.05: d1drbb_
  • Heterogens: CL, CA, MTX, EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1drbA (A:)
misliaalavdrvigmenampwnlpaclawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1drbB (B:)
misliaalavdrvigmenampwnlpaclawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr