PDB entry 1dpy
View 1dpy on RCSB PDB site
Description: three-dimensional structure of a novel phospholipase a2 from indian common krait at 2.45 a resolution
Class: hydrolase
Keywords: indian common krait venom, phospholipase a2, crystal structure, refinement, hydrolase
Deposited on
1999-12-28, released
2000-06-28
The last revision prior to the SCOPe 2.01 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.202
AEROSPACI score: 0.31
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: phospholipase a2
Species: Bungarus caeruleus [TaxId:132961]
Database cross-references and differences (RAF-indexed):
- Uniprot Q9DF52 (0-115)
- conflict (15)
- conflict (21)
- conflict (47)
- conflict (71)
- conflict (79)
- conflict (85)
- conflict (89)
- conflict (108)
- conflict (115)
Domains in SCOPe 2.01: d1dpya_ - Heterogens: NA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1dpyA (A:)
nliqfknmiqcagtriwtayvaygcycgkggsgtpvdeldrccythdhcyneaekipgcn
pniktysytctqpnltctdsadtcaqflcecdrtaaicfasapynsnnimlssstscq
Sequence, based on observed residues (ATOM records): (download)
>1dpyA (A:)
nliqfknmiqcagtriwtayvaygcycgkggsgtpvdeldrccythdhcyneaekipgcn
pniktysytctqpnltctdsadtcaqflcecdrtaaicfasapynsnnimlsstscq