PDB entry 1de1

View 1de1 on RCSB PDB site
Description: nmr structures of oxidized bacteriophage t4 glutaredoxin
Class: electron transport
Keywords: glutaredoxin, electron transport
Deposited on 1999-11-12, released 1999-11-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutaredoxin
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1de1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1de1A (A:)
    mfkvygydsnihkcvycdnakrlltvkkqpfefinimpekgvfddekiaelltklgrdtq
    igltmpqvfapdgshiggfdqlreyfk