PDB entry 1czp

View 1czp on RCSB PDB site
Description: anabaena pcc7119 [2fe-2s] ferredoxin in the reduced and oxixized state at 1.17 a
Class: electron transport
Keywords: [2fe-2s] protein, crystal reduced with dithionite, electron transport
Deposited on 1999-09-06, released 2000-01-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.17 Å
R-factor: 0.143
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin I
    Species: NOSTOC SP. [TaxId:1168]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1czpa_
  • Chain 'B':
    Compound: ferredoxin I
    Species: NOSTOC SP. [TaxId:1168]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1czpb_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1czpA (A:)
    atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
    sdqsfldddqieagyvltcvayptsdvviqthkeedly
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1czpB (B:)
    atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
    sdqsfldddqieagyvltcvayptsdvviqthkeedly