PDB entry 1ctl

View 1ctl on RCSB PDB site
Description: structure of the carboxy-terminal lim domain from the cysteine rich protein crp
Class: metal-binding protein
Keywords: lim domain containing proteins, metal-binding protein
Deposited on 1995-01-06, released 1995-06-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: avian cysteine rich protein
  Species: Gallus gallus [TaxId:9031]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P67966 (0-84)
  Domains in SCOPe 2.05: d1ctla1, d1ctla2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ctlA (A:)
  maqkvggsdgcprcgqavyaaekvigagkswhkscfrcakcgkslesttladkdgeiyck
  gcyaknfgpkgfgfgqgagalihsq