PDB entry 1csz

View 1csz on RCSB PDB site
Description: syk tyrosine kinase c-terminal sh2 domain complexed with a phosphopeptidefrom the gamma chain of the high affinity immunoglobin g receptor, nmr
Class: complex (phosphotransferase/peptide)
Keywords: protein-tyrosine kinase sh2 domain, complex (phosphotransferase/peptide)
Deposited on 1995-10-03, released 1996-11-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: syk protein tyrosine kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1csza_
  • Chain 'B':
    Compound: acetyl-thr-ptr-glu-thr-leu-nh2
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1CSZ

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cszA (A:)
gsrrasvgshekmpwfhgkisreeseqivligsktngkflirardnngsyalcllhegkv
lhyridkdktgklsipegkkfdtlwqlvehysykadgllrvltvpcqkigtq

  • Chain 'B':
    No sequence available.