PDB entry 1cpi

View 1cpi on RCSB PDB site
Description: regioselective structural and functional mimicry of peptides. design of hydrolytically stable cyclic peptidomimetic inhibitors of hiv-1 protease
Class: hydrolase/hydrolase inhibitor
Keywords: HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1995-10-16, released 1996-03-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.163
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • conflict (66)
    • conflict (94)
  Domains in SCOPe 2.01: d1cpia_
• Chain 'B':
  Compound: hiv-1 protease
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • conflict (66)
    • conflict (94)
  Domains in SCOPe 2.01: d1cpib_
• Chain 'C':
  Compound: cyclic peptide inhibitor
  Database cross-references and differences (RAF-indexed):
  • PDB 1CPI (0-End)
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cpiA (A:)
  pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipveiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cpiB (B:)
  pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipveiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'C':
  No sequence available.