PDB entry 1cop

View 1cop on RCSB PDB site
Description: three-dimensional dimer structure of the lambda-cro repressor in solution as determined by heteronuclear multidimensional nmr
Class: gene regulating protein
Keywords: gene regulating protein
Deposited on 1995-06-23, released 1995-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: cro repressor
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: cro
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1copd_
  • Chain 'E':
    Compound: cro repressor
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: cro
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1cope_

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1copD (D:)
    meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfps
    nkktta
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1copE (E:)
    meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfps
    nkktta