PDB entry 1cmg

View 1cmg on RCSB PDB site
Description: nmr solution structure of calcium-loaded calmodulin carboxy-terminal domain
Class: calcium-binding protein
Keywords: calcium-binding protein
Deposited on 1995-07-19, released 1995-12-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin (vertebrate)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1cmga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cmgA (A:)
    mkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgq
    vnyeefvqmmtak