PDB entry 1ciz

View 1ciz on RCSB PDB site
Description: x-ray structure of human stromelysin catalytic domain complexes with non-peptide inhibitors: implication for inhibitor selectivity
Class: metalloproteinase
Keywords: matrix metalloproteinase, mmp-3, non-peptide inhibitor, metalloproteinase
Deposited on 1999-04-06, released 1999-09-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.209
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (stromelysin-1)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ciza_
  • Heterogens: ZN, CA, SO4, DPS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cizA (A:)
    frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
    misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
    ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp