PDB entry 1cdr

View 1cdr on RCSB PDB site
Description: structure of a soluble, glycosylated form of the human complement regulatory protein cd59
Class: complement regulatory protein
Keywords: complement regulatory protein
Deposited on 1994-06-01, released 1994-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cd59
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13987 (0-76)
  Domains in SCOPe 2.08: d1cdra_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cdrA (A:)
  lqcyncpnptadcktavncssdfdaclitkaglqvynkcwkfehcnfndvttrlrenelt
  yycckkdlcnfneqlen