PDB entry 1cck

View 1cck on RCSB PDB site
Description: altering substrate specificity of cytochrome c peroxidase towards a small molecular substrate peroxidase by substituting tyrosine for phe 202
Class: oxidoreductase
Keywords: oxidoreductase, peroxidase
Deposited on 1998-01-02, released 1998-11-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.184
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CCP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (0-290)
      • substitution (49)
      • substitution (148)
      • substitution (198)
    Domains in SCOPe 2.02: d1ccka_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cckA (A:)
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpwgaannvftneyylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl