PDB entry 1c3a

View 1c3a on RCSB PDB site
Description: crystal structure of flavocetin-a from the habu snake venom, a novel cyclic tetramer of c-type lectin-like heterodimers
Class: membrane protein
Keywords: c-type lectin-like domains, membrane protein
Deposited on 1999-07-27, released 2000-03-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.208
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavocetin-a: alpha subunit
    Species: Trimeresurus flavoviridis [TaxId:88087]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1c3aa_
  • Chain 'B':
    Compound: flavocetin-a: beta subunit
    Species: Trimeresurus flavoviridis [TaxId:88087]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1c3ab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c3aA (A:)
dfdcipgwsaydrycyqafskpknwedaesfceegvktshlvsiessgegdfvaqlvaek
iktsfqyvwiglriqnkeqqcrsewsdassvnyenlvkqfskkcyalkkgtelrtwfnvy
cgtenpevckytpec

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c3aB (B:)
gfccplgwssydehcyqvfqqkmnwedaekfctqqhkgshlvsfhsseevdfvtsktfpi
lkydfvwiglsnvwnectkewsdgtkldykawsggsdcivskttdnqwlsmdcsskyyvv
ckfqa