PDB entry 1by9

View 1by9 on RCSB PDB site
Description: crystal structure of the e2 DNA-binding domain from human papillomavirus type-16: implications for its DNA binding-site selection mechanism
Class: transcription regulation
Keywords: papillomavirus, transcription regulation, beta-barrel
Deposited on 1998-10-27, released 1999-04-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.195
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Regulatory protein E2
  Species: Human papillomavirus type 16 [TaxId:333760]
  Gene: E2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03120 (0-End)
  Domains in SCOPe 2.06: d1by9a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1by9A (A:)
  ttpivhlkgdantlkclryrfkkhctlytavsstwhwtghnvkhksaivtltydsewqrd
  qflsqvkipktitvstgfmsi
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1by9A (A:)
  ttpivhlkgdantlkclryrfkkhctlytavsstwhwtaivtltydsewqrdqflsqvki
  pktitvstgfms