PDB entry 1boc

View 1boc on RCSB PDB site
Description: the solution structures of mutant calbindin d9k's, as determined by nmr, show that the calcium binding site can adopt different folds
Class: calcium-binding protein
Keywords: calcium-binding protein
Deposited on 1993-04-23, released 1993-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calbindin d9k
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02633 (1-75)
    • conflict (15)
    • conflict (20)
    • conflict (43)
  Domains in SCOPe 2.06: d1boca_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bocA (A:)
  mkspeelkgifekyadkegdgnqlskeelklllqtefpsllkgmstldelfeeldkngdg
  evsfeefqvlvkkisq